PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G214400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 349aa    MW: 38538 Da    PI: 7.8198
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G214400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.7e-2581125145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Aqcoe3G214400.1.p  81 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVET 125
                        79****************************************997 PP

2QLQ62.21.4e-211853237
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       +FT+ Q+q+L++Q+l++KyL+a++PvPp+L+++i+k
  Aqcoe3G214400.1.p 18 PFTPLQWQELEHQALIFKYLMAGLPVPPDLVLPIKK 53
                       9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.0E-121753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.5421853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.4E-171851IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.44881125IPR014977WRC domain
PfamPF088794.1E-2182124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MNTASSAAAT TTMGFRPPFT PLQWQELEHQ ALIFKYLMAG LPVPPDLVLP IKKSFESMSM  60
SARFFHHPSM GYCSFYGKKV DPEPGRCRRT DGKKWRCSKD AYPDSKYCER HMHRGRNRSR  120
KPVETQTMVQ SSSTLTSLST ASGSSSVGGG TGLPLHSINN PRQGGLCTGT NPSQLQMDSV  180
PYGIGTKEYR YLQGMKQEGE EHSFLSDTSG STRSLGMDSS LDGTWQMMSS KVSSFPQSKS  240
RNGSIMQTDC PEMQTLQDLG HTGLNATLSK QQQHCFFGGE YGLAEPVKPE GQSLRPFFDE  300
WPKTRDSWSD LEDDRSNRTS FFTTQLSISI PMASSDFSAT SSQSPNDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255823.10.0PREDICTED: growth-regulating factor 4-like
TrEMBLU5D2P71e-162U5D2P7_AMBTC; Uncharacterized protein
STRINGVIT_16s0039g01450.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-48growth-regulating factor 5